C1S

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018852

 

Antibody CAB016722

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 BioPorto Diagnostics A/S
 

Product name

HPA018852 ABS 002-09 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

150  

Antigen sequence

AAHVVEGNREPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEG
RTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLMDGDLGLISGWGR
TEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGE
 
 

Matching transcripts

C1S-001 - ENSP00000385035 [100%]
C1S-003 - ENSP00000328173 [100%]
C1S-004 - ENSP00000354057 [100%]
C1S-017 - ENSP00000384171 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows distinct positivity in plasma.
More information
 Plasma shows distinct positivity.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:15 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400655)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.7, 57.5 76.7, 57.5, 40.2, 19.3, 17.4, 11.8, 11.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
C1S-001
 
C1S-003
 
C1S-004
 
C1S-017