FES

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001376

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001376 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

146 

Antigen sequence

DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHH
QHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHRE
MAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
 

Matching transcripts

FES-001 - ENSP00000331504 [100%]
FES-003 - ENSP00000435811 [100%]
FES-005 - ENSP00000377837 [100%]
FES-006 - ENSP00000377839 [100%]
FES-017 - ENSP00000414629 [100%]
FES-018 - ENSP00000400868 [100%]
FES-201 - ENSP00000409915 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

93.5, 86.7, 85.5, 78.6, 76.8, 62.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FES-001
 
FES-003
 
FES-005
 
FES-006
 
FES-017
 
FES-018
 
FES-201