C11orf54

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040088

 

Antibody HPA040511

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040088 HPA040511 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

100 80 

Antigen sequence

MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPV
KGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG
 
TLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQ
CALLANLFASEGQPGKVIEVKAKRRTGPLN
 

Matching transcripts

C11orf54-001 - ENSP00000433721 [100%]
C11orf54-002 - ENSP00000331209 [100%]
C11orf54-003 - ENSP00000346403 [100%]
C11orf54-004 - ENSP00000435113 [100%]
C11orf54-006 - ENSP00000434627 [100%]
C11orf54-009 - ENSP00000435204 [100%]
C11orf54-011 - ENSP00000435729 [100%]
C11orf54-012 - ENSP00000435231 [100%]
C11orf54-014 - ENSP00000434065 [96%]
C11orf54-015 - ENSP00000434382 [81%]
C11orf54-201 - ENSP00000442094 [81%]
 C11orf54-002 - ENSP00000331209 [100%]
C11orf54-003 - ENSP00000346403 [100%]
C11orf54-004 - ENSP00000435113 [100%]
C11orf54-015 - ENSP00000434382 [100%]
C11orf54-201 - ENSP00000442094 [100%]
C11orf54-013 - ENSP00000433723 [90%]
C11orf54-011 - ENSP00000435729 [85%]
C11orf54-001 - ENSP00000433721 [84%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:3000 1:1500 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane.
More information
 

Antibody dilution

1:182 1:189 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

35.1, 33.1, 29.5, 26.3, 20.4, 18.5, 16.1, 10.7, 10.4 35.1, 33.1, 29.5, 26.3, 21.1, 18.5 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
C11orf54-001
 
C11orf54-002
 
C11orf54-003
 
C11orf54-004
 
C11orf54-006
 
C11orf54-009
 
C11orf54-011
 
C11orf54-012
 
C11orf54-013
 
C11orf54-014
 
C11orf54-015
 
C11orf54-201
 
 »