RIPK4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021158

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021158 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

91 

Antigen sequence

WGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQ
RCWQGDPRVRPTFQEITSETEDLCEKPDDEVKETAHDLDVK
 

Matching transcripts

RIPK4-001 - ENSP00000332454 [100%]
RIPK4-202 - ENSP00000442901 [100%]
RIPK4-203 - ENSP00000441754 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong positivity in subsets of cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

1:36 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

86.4, 79.4 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RIPK4-001
 
RIPK4-202
 
RIPK4-203