KIRREL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003501

 

Antibody HPA030458

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003501 HPA030458 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

136 142 

Antigen sequence

VRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQLNTYSRGP
ASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLG
YPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHS
 
VTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYET
NVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSD
VTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADA
 

Matching transcripts

KIRREL-001 - ENSP00000352138 [100%]
KIRREL-002 - ENSP00000353202 [100%]
KIRREL-003 - ENSP00000357154 [100%]
KIRREL-201 - ENSP00000357155 [100%]
KIRREL-202 - ENSP00000376098 [100%]
KIRREL-203 - ENSP00000389674 [100%]
 KIRREL-001 - ENSP00000352138 [100%]
KIRREL-002 - ENSP00000353202 [100%]
KIRREL-202 - ENSP00000376098 [100%]
KIRREL-203 - ENSP00000389674 [100%]
KIRREL-003 - ENSP00000357154 [90%]
KIRREL-201 - ENSP00000357155 [90%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:18 1:5 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.0, 83.5, 72.7, 72.4, 65.7, 63.1 85.0, 83.5, 72.7, 72.4, 65.7, 63.1 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human kidney shows cytoplasmic positivity in podocytes in glomeruli.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:60 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNAseq data 
 

ANTIGEN VIEW

? »
 
 
 
KIRREL-001
 
KIRREL-002
 
KIRREL-003
 
KIRREL-201
 
KIRREL-202
 
KIRREL-203