IRAK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA054476

 

Antibody CAB004461

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA054476 sc-5288 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

91  

Antigen sequence

GAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSG
QRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHP
 
 

Matching transcripts

IRAK1-001 - ENSP00000358991 [100%]
IRAK1-002 - ENSP00000377291 [100%]
IRAK1-012 - ENSP00000358997 [100%]
IRAK1-017 - ENSP00000399974 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.5, 73.4, 68.0, 25.3 76.5, 76.1, 74.6, 73.4, 68.0, 42.1, 37.0, 28.9, 25.3, 23.5, 22.6 

Antibody dilution

1:330 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus & cytoplasm.
More information
  

Antibody dilution

1:66  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
IRAK1-001
 
IRAK1-002
 
IRAK1-012
 
IRAK1-017