SRPK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042489

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042489 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

86 

Antigen sequence

PSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEA
MEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPS
 

Matching transcripts

SRPK3-006 - ENSP00000359119 [100%]
SRPK3-007 - ENSP00000420058 [100%]
SRPK3-005 - ENSP00000359122 [99%]
SRPK3-001 - ENSP00000359126 [88%]
SRPK3-002 - ENSP00000359118 [88%]
SRPK3-201 - ENSP00000377376 [86%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1200 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

69.2, 62.0, 61.9, 59.1, 59.0, 55.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SRPK3-001
 
SRPK3-002
 
SRPK3-005
 
SRPK3-006
 
SRPK3-007
 
SRPK3-201