NUTM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040421

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040421 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

78 

Antigen sequence

TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQG
LGSTLPRRGTRNAIVPRETSVSKTHRSA
 

Matching transcripts

NUTM1-001 - ENSP00000444896 [100%]
NUTM1-002 - ENSP00000329448 [100%]
NUTM1-004 - ENSP00000407031 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in spermatids.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:850 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

123.3, 122.5, 120.3 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:30000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NUTM1-001
 
NUTM1-002
 
NUTM1-004