AC132216.1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038214

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038214 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

57 

Antigen sequence

ASLMSRASLMPAQARAPFQRLRDCRGPADSSHAFKLQCFPSHCRRPPWVI
SRKGRAI
 

Matching transcripts

AC132216.1-201 - ENSP00000332722 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

13.7 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
AC132216.1-201