ARMCX2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005761

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005761 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

145 

Antigen sequence

RDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPVRAEAE
DRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESV
VGAAMASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRA
 

Matching transcripts

ARMCX2-011 - ENSP00000331662 [100%]
ARMCX2-012 - ENSP00000349281 [100%]
ARMCX2-013 - ENSP00000328631 [100%]
ARMCX2-003 - ENSP00000412481 [94%]
ARMCX2-007 - ENSP00000410151 [93%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islet cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

65.7, 16.4, 16.2 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARMCX2-003
 
ARMCX2-007
 
ARMCX2-011
 
ARMCX2-012
 
ARMCX2-013