CIB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048825

 

Antibody CAB012991

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA048825 35-4500 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

83  

Antigen sequence

DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLID
NILEESDIDRDGTINLSEFQHVISRSPDFASSF
 
 

Matching transcripts

CIB1-001 - ENSP00000333873 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human colon shows distinct positivity in endothelial cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:80 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

21.7 21.7 

Antibody dilution

1:2910 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-549 shows positivity in plasma membrane & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:200  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:23250  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
CIB1-001