PRKG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007699

 

Antibody CAB009629

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA007699 sc-25429 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

117  

Antigen sequence

LADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLR
TLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVS
NKAYEDAEAKAKYEAEA
 
 

Matching transcripts

PRKG1-001 - ENSP00000363097 [100%]
PRKG1-002 - ENSP00000363092 [100%]
PRKG1-201 - ENSP00000384200 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells(ducts).
More information
 Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:175 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:20  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

  

Target mass (kDa)

77.8, 76.4, 75.0 77.8, 76.4, 75.0, 44.2, 20.5 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PRKG1-001
 
PRKG1-002
 
PRKG1-201