PCYT2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023033

 

Antibody HPA023034

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023033 HPA023034 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

81 97 

Antigen sequence

LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVG
RMLLVTKAHHSSQEMSSEYREYADSFGKCPG
 
TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTT
DLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF
 

Matching transcripts

PCYT2-001 - ENSP00000439245 [100%]
PCYT2-002 - ENSP00000459044 [100%]
PCYT2-005 - ENSP00000458330 [100%]
PCYT2-006 - ENSP00000331719 [100%]
PCYT2-007 - ENSP00000461190 [100%]
PCYT2-003 - ENSP00000442050 [98%]
PCYT2-009 - ENSP00000458931 [84%]
 PCYT2-001 - ENSP00000439245 [100%]
PCYT2-003 - ENSP00000442050 [100%]
PCYT2-005 - ENSP00000458330 [100%]
PCYT2-006 - ENSP00000331719 [100%]
PCYT2-007 - ENSP00000461190 [100%]
PCYT2-014 - ENSP00000460767 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong positivity in tubular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:800 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.6, 43.8, 41.4, 40.5, 35.4, 35.2 45.6, 43.8, 40.5, 35.2, 23.2 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in centrosome.
More information
 

Antibody dilution

 1:400 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
PCYT2-001
 
PCYT2-002
 
PCYT2-003
 
PCYT2-005
 
PCYT2-006
 
PCYT2-007
 
PCYT2-009
 
PCYT2-014