EVI2B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007436

 

Antibody HPA053383

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007436 HPA053383 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

129 142 

Antigen sequence

ETPDICMDNIRENEISTKRTSIISLTPWKPSKSTLLADDLEIKLFESSEN
IEDSNNPKTEKIKDQVNGTSEDSADGSTVGTAVSSSDDADLPPPPPLLDL
EGQESNQSDKPTMTIVSPLPNDSTSLPPS
 
SQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEK
PEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKS
FVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPG
 

Matching transcripts

EVI2B-001 - ENSP00000333779 [100%]
EVI2B-002 - ENSP00000462682 [100%]
EVI2B-201 - ENSP00000439738 [100%]
 EVI2B-001 - ENSP00000333779 [100%]
EVI2B-002 - ENSP00000462682 [100%]
EVI2B-201 - ENSP00000439738 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:150  

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.6, 48.7 50.6, 48.7 

Antibody dilution

1:250 1:360 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:2850 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus, nuclear membrane & vesicles.
More information
 

Antibody dilution

 1:71 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
EVI2B-001
 
EVI2B-002
 
EVI2B-201