DYNC2H1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039015

 

Antibody HPA039016

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039015 HPA039016 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

95 98 

Antigen sequence

LLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAK
LQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDA
 
DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIA
RSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLN
 

Matching transcripts

DYNC2H1-001 - ENSP00000364887 [100%]
DYNC2H1-002 - ENSP00000334021 [100%]
DYNC2H1-005 - ENSP00000381167 [100%]
DYNC2H1-007 - ENSP00000436736 [100%]
 DYNC2H1-001 - ENSP00000364887 [100%]
DYNC2H1-005 - ENSP00000381167 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

1:44 1:104 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

493.4, 492.6, 105.4, 25.0 493.4, 492.6 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DYNC2H1-001
 
DYNC2H1-002
 
DYNC2H1-005
 
DYNC2H1-007