SIRT7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027284

 

Antibody HPA053669

 

Antibody CAB037261

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA027284 HPA053669 S5947 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 13 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

84 95  

Antigen sequence

LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMS
ITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE
 
TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAG
EEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTK
 
 

Matching transcripts

SIRT7-001 - ENSP00000329466 [100%]
 SIRT7-001 - ENSP00000329466 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & vesicles.
More information
 

Antibody dilution

1:34  1:200 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

44.9 44.9 44.9, 17.1, 13.3 

Antibody dilution

1:250 1:1140 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:9100  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human skin shows nucleolar positivity in epidermal cells.
More information
 Immunohistochemical staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:1000 1:1200 

Literature conformity

 Consistent with gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNAseq data Mainly consistent with RNAseq data 
 

ANTIGEN VIEW

? »
 
 
 
SIRT7-001