HYKK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040706

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040706 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

80 

Antigen sequence

ALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT
EYVLKISNTKASKNPDLIEVQNHIIMFLKA
 

Matching transcripts

HYKK-001 - ENSP00000455459 [100%]
HYKK-002 - ENSP00000454850 [100%]
HYKK-003 - ENSP00000456614 [100%]
HYKK-004 - ENSP00000457154 [100%]
HYKK-201 - ENSP00000353710 [100%]
HYKK-202 - ENSP00000373640 [100%]
HYKK-203 - ENSP00000386197 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

41.9, 25.6, 24.9, 18.8 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HYKK-001
 
HYKK-002
 
HYKK-003
 
HYKK-004
 
HYKK-201
 
HYKK-202
 
HYKK-203