ZNF573

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042776

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042776 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

40 

Antigen sequence

DLDLQCEIISYIEVPTYETDISSTQLQSIYKREKLYECKK
 

Matching transcripts

ZNF573-001 - ENSP00000367706 [100%]
ZNF573-004 - ENSP00000375983 [100%]
ZNF573-007 - ENSP00000465020 [100%]
ZNF573-201 - ENSP00000340171 [100%]
ZNF573-202 - ENSP00000349861 [100%]
ZNF573-203 - ENSP00000440464 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1200 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoskeleton (intermediate filaments).
More information
 

Antibody dilution

1:95 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

78.2, 70.8, 67.9, 67.8, 16.8 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ZNF573-001
 
ZNF573-004
 
ZNF573-007
 
ZNF573-201
 
ZNF573-202
 
ZNF573-203