PAX5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA056394

 

Antibody CAB026269

 

Antibody CAB026869

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 R&D Systems
 

Product name

HPA056394 RM-9133-S0 AF3487 

Host species

Rabbit Rabbit Goat 

Clonality

pAb mAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

13 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

53   

Antigen sequence

SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQ
QQL
 
 
 

Matching transcripts

PAX5-001 - ENSP00000350844 [100%]
PAX5-002 - ENSP00000367071 [100%]
PAX5-003 - ENSP00000367083 [100%]
PAX5-004 - ENSP00000367084 [100%]
PAX5-006 - ENSP00000429637 [100%]
PAX5-007 - ENSP00000429291 [100%]
PAX5-008 - ENSP00000404687 [100%]
PAX5-009 - ENSP00000429359 [100%]
PAX5-010 - ENSP00000429197 [100%]
PAX5-011 - ENSP00000431038 [100%]
PAX5-012 - ENSP00000367078 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human appendix shows strong nuclear positivity in lymphoid tissue.
More information
 Immunohistochemical staining of human tonsil shows distinct nuclear positivity in the white pulp.
More information
 Immunohistochemical staining of human tonsil shows distinct nuclear positivity in reaction center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:80 1:120 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.1, 38.9, 38.8, 35.5, 35.3, 34.1, 32.5, 31.8, 31.4, 30.3, 23.7 42.1, 38.9, 38.8, 37.8, 35.5, 35.3, 34.6, 34.1, 32.5, 31.8, 31.4, 30.3, 23.8, 23.7, 6.0 42.1, 38.9, 38.8, 37.8, 35.5, 35.3, 34.6, 34.1, 32.5, 31.8, 31.4, 30.3, 23.8, 23.7, 6.0 

Antibody dilution

1:590 1:500 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:7100   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 « 
 
PAX5-001
 
PAX5-002
 
PAX5-003
 
PAX5-004
 
PAX5-006
 
PAX5-007
 
PAX5-008
 
PAX5-009
 
PAX5-010
 
PAX5-011
 
PAX5-012
 
 »