LONP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002034

 

Antibody HPA002192

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002034 HPA002192 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

150 142 

Antigen sequence

PAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQ
MMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLL
KKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA
 
VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPK
HVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLAR
AQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
 

Matching transcripts

LONP1-001 - ENSP00000353826 [100%]
LONP1-002 - ENSP00000441523 [100%]
LONP1-003 - ENSP00000465585 [100%]
LONP1-005 - ENSP00000468541 [100%]
LONP1-007 - ENSP00000465139 [89%]
 LONP1-001 - ENSP00000353826 [100%]
LONP1-002 - ENSP00000441523 [100%]
LONP1-003 - ENSP00000465585 [100%]
LONP1-005 - ENSP00000468541 [100%]
LONP1-007 - ENSP00000465139 [100%]
LONP1-014 - ENSP00000468083 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in mitochondria.
More information
 

Antibody dilution

1:30 1:10 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

106.5, 100.4, 95.2, 93.3, 85.6 106.5, 100.4, 95.2, 93.3, 85.6, 27.5 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:15 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
LONP1-001
 
LONP1-002
 
LONP1-003
 
LONP1-005
 
LONP1-007
 
LONP1-014