ARMCX4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000429

 

Antibody HPA051930

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000429 HPA051930 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

140 87 

Antigen sequence

GRAQSVRTLARNGSTVKMETVVGVQSQTLAINEAEIKTKPQVEIGAETGA
RSGPRAEVETKATAIAIHRANSQAKAMVGAEPETQSESKVVAGTLVMTEA
VTLTEVKAKAREVAMKEAVTQTDAEAGKIVKKEAVTQTKA
 
TKFAHQSEASFPVEDESRKQTRTGEKTRPWSCRCKHEANMDPRDLEKLIC
MIEMTEDPSVHEIANNALYNSADYSYSHEVVRNVGGI
 

Matching transcripts

ARMCX4-001 - ENSP00000423927 [100%]
ARMCX4-002 - ENSP00000423440 [100%]
ARMCX4-003 - ENSP00000425302 [100%]
ARMCX4-006 - ENSP00000424452 [100%]
ARMCX4-010 - ENSP00000404304 [100%]
 ARMCX4-010 - ENSP00000404304 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human appendix shows cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

236.0, 39.4, 37.9 236.0 

Antibody dilution

1:500 1:270 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 1:2150 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line CACO-2 shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:53 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
ARMCX4-001
 
ARMCX4-002
 
ARMCX4-003
 
ARMCX4-006
 
ARMCX4-010