CACNA1H

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039125

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039125 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

91 

Antigen sequence

EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPG
RADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP
 

Matching transcripts

CACNA1H-001 - ENSP00000334198 [100%]
CACNA1H-002 - ENSP00000455840 [100%]
CACNA1H-003 - ENSP00000457555 [100%]
CACNA1H-004 - ENSP00000454990 [100%]
CACNA1H-005 - ENSP00000454581 [100%]
CACNA1H-006 - ENSP00000455512 [100%]
CACNA1H-201 - ENSP00000351401 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

259.2, 258.5, 120.9, 119.5, 118.9, 98.5 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CACNA1H-001
 
CACNA1H-002
 
CACNA1H-003
 
CACNA1H-004
 
CACNA1H-005
 
CACNA1H-006
 
CACNA1H-201