CD47

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044659

 

Antibody CAB016055

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA044659 sc-12730 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

118  

Antigen sequence

AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYT
FDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVT
ELTREGETIIELKYRVVS
 
 

Matching transcripts

CD47-002 - ENSP00000347512 [100%]
CD47-004 - ENSP00000355361 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.
More information
 Immunohistochemical staining of human urinary bladder shows moderate membranous positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:600 1:25 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, golgi apparatus & vesicles.
More information
 

Antibody dilution

 1:40 

Validation IF

 Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

35.2, 33.2 35.2, 33.2, 11.4, 9.9 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
CD47-002
 
CD47-004