ANXA6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002462

 

Antibody HPA009650

 

Antibody CAB005077

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA002462 HPA009650 sc-1931 

Host species

Rabbit Rabbit Goat 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

2 4 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

114 142  

Antigen sequence

LVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQ
DVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEAS
IRGELSGDFEKLML
 
IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKE
MSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSE
IDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
 
 

Matching transcripts

ANXA6-001 - ENSP00000346550 [100%]
ANXA6-004 - ENSP00000430517 [100%]
ANXA6-201 - ENSP00000348889 [100%]
 ANXA6-001 - ENSP00000346550 [100%]
ANXA6-002 - ENSP00000430420 [100%]
ANXA6-003 - ENSP00000366980 [100%]
ANXA6-004 - ENSP00000430517 [100%]
ANXA6-201 - ENSP00000348889 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human spleen shows cytoplasmic positivity in cells of red pulp and white pulp.
More information
 Immunohistochemical staining of human kidney shows strong membranous positivity in cells of tubules.
More information
 Immunohistochemical staining of human pancreas shows distinct membranous and cytoplasmic positivity in islet cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:350 1:100 1:1250 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

75.9, 75.3, 72.4 75.9, 75.3, 72.4, 51.8, 37.0 75.9, 75.3, 72.4, 51.8, 37.0, 17.5, 16.9, 14.7, 14.4, 12.2, 10.5, 10.0 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ANXA6-001
 
ANXA6-002
 
ANXA6-003
 
ANXA6-004
 
ANXA6-201