DYNC1H1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003742

 

Antibody CAB010443

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA003742 sc-9115 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

142  

Antigen sequence

RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERIL
GVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHE
LRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR
 
 

Matching transcripts

DYNC1H1-001 - ENSP00000348965 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in basal cells of the seminiferus ducts.
More information
 Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:200 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

Target mass (kDa)

532.4 532.4, 20.9 

Antibody dilution

  

Validation WB

  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & centrosome.
More information
 

Antibody dilution

 1:50 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
DYNC1H1-001