ACSL5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007162

 

Antibody CAB062546

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 

Product name

HPA007162 AMAb90634 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

98  

Antigen sequence

VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQ
RGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK
 
 

Matching transcripts

ACSL5-001 - ENSP00000346223 [100%]
ACSL5-002 - ENSP00000346680 [100%]
ACSL5-201 - ENSP00000348429 [100%]
ACSL5-203 - ENSP00000376796 [100%]
ACSL5-204 - ENSP00000403647 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & mitochondria.
More information
 Application not done for this antibody. 

Antibody dilution

1:22  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414108)
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

82.3, 76.0, 73.3 82.3, 76.0, 73.3, 51.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACSL5-001
 
ACSL5-002
 
ACSL5-201
 
ACSL5-203
 
ACSL5-204