SERPINA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000927

 

Antibody HPA001292

 

Antibody CAB013211

 

Antibody CAB016648

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 AbFrontier
 

Product name

HPA000927 HPA001292 18-0002 LF-MA0175 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Ammonium Sulfate Precipitation 

Released in version

4 4 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Native protein 

Length (aa)

150 155   

Antigen sequence

HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLS
LGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTG
NGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
 
GMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITK
FLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEE
APLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLM
GAPHR
 
 
 

Matching transcripts

SERPINA1-001 - ENSP00000390299 [97%]
SERPINA1-002 - ENSP00000376803 [97%]
SERPINA1-003 - ENSP00000385960 [97%]
SERPINA1-004 - ENSP00000376802 [97%]
SERPINA1-005 - ENSP00000451525 [97%]
SERPINA1-006 - ENSP00000386094 [97%]
SERPINA1-008 - ENSP00000416354 [97%]
SERPINA1-201 - ENSP00000348068 [97%]
SERPINA1-202 - ENSP00000408474 [97%]
SERPINA1-203 - ENSP00000416066 [97%]
 SERPINA1-001 - ENSP00000390299 [97%]
SERPINA1-002 - ENSP00000376803 [97%]
SERPINA1-003 - ENSP00000385960 [97%]
SERPINA1-004 - ENSP00000376802 [97%]
SERPINA1-008 - ENSP00000416354 [97%]
SERPINA1-201 - ENSP00000348068 [97%]
SERPINA1-202 - ENSP00000408474 [97%]
SERPINA1-203 - ENSP00000416066 [97%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human kidney shows positivity in plasma and cells in tubules.
More information
 Immunohistochemical staining of human kidney shows positivity in plasma and cells in tubules.
More information
 Immunohistochemical staining of human kidney shows positivity in plasma and cells in tubules.
More information
 Immunohistochemical staining of human kidney shows positivity of plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:4000 1:1000 1:100 1:30000 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.7, 40.3, 34.8 46.7 46.7, 40.3, 34.8, 17.1, 15.7, 12.7, 11.8, 9.9, 2.2 46.7, 40.3, 34.8, 17.1, 15.7, 12.7, 11.8, 9.9, 2.2 

Antibody dilution

1:500 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:1000 1:500   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
SERPINA1-001
 
SERPINA1-002
 
SERPINA1-003
 
SERPINA1-004
 
SERPINA1-005
 
SERPINA1-006
 
SERPINA1-008
 
SERPINA1-201
 
SERPINA1-202
 
SERPINA1-203