GOLGA6L1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047733

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA047733 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

39 

Antigen sequence

ADHLGKELQSVSAKLQAQVEENELWNRLNQQQEEKMWRQ
 

Matching transcripts

GOLGA6L1-002 - ENSP00000452626 [100%]
GOLGA6L1-201 - ENSP00000320207 [100%]
 

Other gene match

GOLGA6L6 - ENSG00000215405 [100%]
RP11-467N20.5 - ENSG00000259455 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in a subset of trophoblastic cells. .
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:200 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

 

Description

 

Target mass (kDa)

107.8, 94.2, 83.1, 77.3 

Antibody dilution

1:290 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2300 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GOLGA6L1-002
 
GOLGA6L1-201