RPE

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036498

 

Antibody HPA036499

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036498 HPA036499 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

71 82 

Antigen sequence

MVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKP
GTSVEYLAPWANQIDMALVMT
 
VEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGAN
MIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
 

Matching transcripts

RPE-001 - ENSP00000352401 [100%]
RPE-004 - ENSP00000411186 [100%]
RPE-005 - ENSP00000389411 [100%]
RPE-010 - ENSP00000386194 [100%]
RPE-011 - ENSP00000392279 [100%]
RPE-012 - ENSP00000400449 [100%]
RPE-013 - ENSP00000405695 [100%]
RPE-014 - ENSP00000416805 [100%]
RPE-016 - ENSP00000402061 [100%]
RPE-202 - ENSP00000439206 [100%]
RPE-002 - ENSP00000394455 [80%]
RPE-003 - ENSP00000401838 [80%]
RPE-007 - ENSP00000397674 [80%]
RPE-008 - ENSP00000403808 [80%]
RPE-009 - ENSP00000412245 [80%]
RPE-201 - ENSP00000346501 [80%]
 RPE-001 - ENSP00000352401 [100%]
RPE-002 - ENSP00000394455 [100%]
RPE-003 - ENSP00000401838 [100%]
RPE-005 - ENSP00000389411 [100%]
RPE-008 - ENSP00000403808 [100%]
RPE-010 - ENSP00000386194 [100%]
RPE-016 - ENSP00000402061 [100%]
RPE-201 - ENSP00000346501 [100%]
 

Other gene match

RPEL1 - ENSG00000235376 [97%]
 RPEL1 - ENSG00000235376 [94%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human skin shows strong cytoplasmic positivity in subsets of epidermal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:425 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404697)
More information
 

Target mass (kDa)

25.0, 24.9, 24.0, 21.7, 21.0, 19.5, 17.6, 17.4, 16.3, 15.7, 12.0, 10.4 25.0, 24.9, 24.0, 19.5, 17.6, 17.4 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:66 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
RPE-001
 
RPE-002
 
RPE-003
 
RPE-004
 
RPE-005
 
RPE-007
 
RPE-008
 
RPE-009
 
RPE-010
 
RPE-011
 
RPE-012
 
RPE-013
 
RPE-014
 
RPE-016
 
RPE-201
 
RPE-202
 
 »