MYO1C

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001768

 

Antibody CAB037023

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA001768 M3567 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

148  

Antigen sequence

GEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDKSDWKVVRKALTVIDF
TEDEVEDLLSIVASVLHLGNIHFAANEESNAQVTTENQLKYLTRLLSVEG
STLREALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVYSRTFTWLV
 
 

Matching transcripts

MYO1C-001 - ENSP00000352834 [100%]
MYO1C-002 - ENSP00000459174 [100%]
MYO1C-003 - ENSP00000437685 [100%]
MYO1C-010 - ENSP00000412197 [100%]
MYO1C-201 - ENSP00000354283 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human gall bladder shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:350 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A549 shows positivity in plasma membrane, mitochondria & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:24  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

121.7, 119.6, 119.0, 117.9 121.7, 119.6, 119.0, 117.9, 30.7, 19.5, 19.2, 18.7, 15.9, 15.4, 7.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MYO1C-001
 
MYO1C-002
 
MYO1C-003
 
MYO1C-010
 
MYO1C-201