ZNF84

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028860

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028860 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

143 

Antigen sequence

SLGYEVMKPDVIFKLEQGEEPWVGDGEIPSSDSPEVWKVDGNMMWHQDNQ
DKLKIIKRGHECDAFGKNFNLNMNFVPLRKSNSEGDLDGLILKHHLDLLI
PKGDYGKAESDDFNVFDNFFLHSKPEDTDTWLKYYDCDKYKES
 

Matching transcripts

ZNF84-001 - ENSP00000331465 [100%]
ZNF84-002 - ENSP00000445549 [100%]
ZNF84-013 - ENSP00000445820 [100%]
ZNF84-201 - ENSP00000376133 [100%]
ZNF84-003 - ENSP00000437949 [99%]
 

Other gene match

ZNF84 - ENSG00000218497 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.5, 85.3, 27.8 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ZNF84-001
 
ZNF84-002
 
ZNF84-003
 
ZNF84-013
 
ZNF84-201