LPAR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050667

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA050667 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

50 

Antigen sequence

RDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSV
 

Matching transcripts

LPAR1-001 - ENSP00000363553 [100%]
LPAR1-002 - ENSP00000363552 [100%]
LPAR1-003 - ENSP00000351755 [100%]
LPAR1-201 - ENSP00000440201 [100%]
LPAR1-202 - ENSP00000445697 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:62 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

41.3, 41.2, 41.1 

Antibody dilution

1:310 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
LPAR1-001
 
LPAR1-002
 
LPAR1-003
 
LPAR1-201
 
LPAR1-202