DDX39B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055334

 

Antibody HPA058450

 

Antibody CAB034012

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA055334 HPA058450 sc-68342 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

66 25  

Antigen sequence

YVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQ
AKSGMGKTAVFVLATL
 
MAENDVDNELLDYEDDEVETAAGGD
 
 

Matching transcripts

DDX39B-001 - ENSP00000379475 [100%]
DDX39B-002 - ENSP00000416269 [100%]
DDX39B-006 - ENSP00000365347 [100%]
DDX39B-009 - ENSP00000392672 [100%]
DDX39B-010 - ENSP00000405245 [100%]
DDX39B-011 - ENSP00000399841 [100%]
DDX39B-012 - ENSP00000393984 [100%]
DDX39B-013 - ENSP00000405707 [100%]
DDX39B-014 - ENSP00000416350 [100%]
DDX39B-016 - ENSP00000409426 [100%]
DDX39B-017 - ENSP00000399371 [100%]
DDX39B-018 - ENSP00000410313 [100%]
DDX39B-202 - ENSP00000412582 [100%]
DDX39B-203 - ENSP00000391946 [100%]
 DDX39B-001 - ENSP00000379475 [100%]
DDX39B-002 - ENSP00000416269 [100%]
DDX39B-006 - ENSP00000365347 [100%]
DDX39B-009 - ENSP00000392672 [100%]
DDX39B-010 - ENSP00000405245 [100%]
DDX39B-011 - ENSP00000399841 [100%]
DDX39B-012 - ENSP00000393984 [100%]
DDX39B-013 - ENSP00000405707 [100%]
DDX39B-014 - ENSP00000416350 [100%]
DDX39B-016 - ENSP00000409426 [100%]
DDX39B-017 - ENSP00000399371 [100%]
DDX39B-018 - ENSP00000410313 [100%]
DDX39B-202 - ENSP00000412582 [100%]
DDX39B-203 - ENSP00000391946 [100%]
  

Other gene match

DDX39A - ENSG00000123136 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts and Leydig cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:150  1:125 

Literature conformity

Consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:5 1:31 

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.7, 49.1, 49.0, 48.8, 36.6, 32.9, 30.5, 28.8, 26.7, 26.5, 25.9, 21.9, 21.3, 20.5, 19.0, 14.9, 14.7, 14.4, 14.3, 13.8, 13.5, 11.9, 10.2 50.7, 49.0, 48.8, 32.9, 26.7, 26.5, 25.9, 21.9, 20.5, 14.9, 14.7, 14.3, 13.5 50.7, 49.0, 48.8, 40.6, 32.9, 28.3, 27.7, 26.7, 26.5, 25.9, 21.9, 21.7, 20.5, 16.5, 14.9, 14.7, 14.3, 13.5 

Antibody dilution

1:380 1:80 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3100 1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
DDX39B-001
 
DDX39B-002
 
DDX39B-006
 
DDX39B-009
 
DDX39B-010
 
DDX39B-011
 
DDX39B-012
 
DDX39B-013
 
DDX39B-014
 
DDX39B-016
 
DDX39B-017
 
DDX39B-018
 
DDX39B-202
 
DDX39B-203
 
 »