ZNF277

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027307

 

Antibody HPA041811

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027307 HPA041811 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

126 136 

Antigen sequence

FPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFC
SVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQER
NDTNFHGVCMFCNEEFLGNRSVILNH
 
CLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLELGKSWEE
VQLEDDRELLDHQEDDWSDWEEHPASAVCLFCEKQAETIEKLYVHMEDAH
EFDLLKIKSELGLNFYQQVKLVNFIRRQVHQCRCYG
 

Matching transcripts

ZNF277-001 - ENSP00000354501 [100%]
ZNF277-003 - ENSP00000402292 [100%]
 ZNF277-001 - ENSP00000354501 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong nuclear staining in reaction center cells while subsets of cells outside the reaction center displayed strong positivity the cytoplasm.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:250  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
 

Antibody dilution

1:100 1:7 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

52.8, 33.9 52.8 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ZNF277-001
 
ZNF277-003