MAP3K3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035410

 

Antibody HPA035411

 

Antibody CAB007764

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA035410 HPA035411 1673-1 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

12 12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

83 83  

Antigen sequence

NELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVS
RQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQ
 
EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSAL
LNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE
 
 

Matching transcripts

MAP3K3-001 - ENSP00000354927 [100%]
MAP3K3-002 - ENSP00000464130 [100%]
MAP3K3-004 - ENSP00000354485 [100%]
MAP3K3-005 - ENSP00000462086 [100%]
MAP3K3-007 - ENSP00000461988 [100%]
 MAP3K3-001 - ENSP00000354927 [100%]
MAP3K3-002 - ENSP00000464130 [100%]
MAP3K3-007 - ENSP00000461988 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:500 1:15 

Validation IH

 Uncertain: Two (or more) antibodies yielding dissimilar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

74.1, 73.7, 70.9, 70.5 74.1, 73.7 74.1, 73.7, 70.9, 70.5, 6.3, 4.6, 3.3 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
   

Antibody dilution

1:52   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MAP3K3-001
 
MAP3K3-002
 
MAP3K3-004
 
MAP3K3-005
 
MAP3K3-007