APRT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026681

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA026681 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

64 

Antigen sequence

MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHL
KATHGGRIDYIAGD
 

Matching transcripts

APRT-001 - ENSP00000367615 [98%]
APRT-002 - ENSP00000397007 [98%]
APRT-007 - ENSP00000455749 [98%]
APRT-009 - ENSP00000456905 [98%]
APRT-010 - ENSP00000457964 [98%]
APRT-011 - ENSP00000456012 [98%]
APRT-008 - ENSP00000455692 [97%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:80 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:20 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

19.6, 17.5, 16.6, 16.4, 14.6, 6.9 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
APRT-001
 
APRT-002
 
APRT-007
 
APRT-008
 
APRT-009
 
APRT-010
 
APRT-011