CR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042455

 

Antibody HPA043579

 

Antibody HPA049348

 

Antibody CAB002491

 

Antibody CAB016271

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 Santa Cruz Biotechnology
 

Product name

HPA042455 HPA043579 HPA049348 NCL-CD35 sc-7308 

Host species

Rabbit Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

10 10 10 1 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known Not known 

Length (aa)

67 34 57   

Antigen sequence

LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFH
NGTVVTYQCHTGPDGEQ
 
GNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEEN
 
VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCE
PGYDLRG
 
 
 

Matching transcripts

CR1-001 - ENSP00000383744 [100%]
CR1-002 - ENSP00000356018 [100%]
CR1-003 - ENSP00000356020 [100%]
CR1-007 - ENSP00000356019 [100%]
CR1-010 - ENSP00000436139 [100%]
CR1-012 - ENSP00000356016 [100%]
 CR1-001 - ENSP00000383744 [100%]
CR1-002 - ENSP00000356018 [100%]
CR1-003 - ENSP00000356020 [100%]
CR1-007 - ENSP00000356019 [100%]
CR1-011 - ENSP00000434718 [100%]
CR1-012 - ENSP00000356016 [100%]
 CR1-001 - ENSP00000383744 [100%]
CR1-002 - ENSP00000356018 [100%]
CR1-003 - ENSP00000356020 [100%]
CR1-007 - ENSP00000356019 [100%]
CR1-010 - ENSP00000436139 [100%]
CR1-011 - ENSP00000434718 [100%]
CR1-012 - ENSP00000356016 [100%]
   

Other gene match

  CR1L - ENSG00000197721 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human kidney shows strong positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.
More information
 Immunohistochemical staining of human tonsil shows distinct reticular positivity in germinal center.
More information
 Immunohistochemical staining of human kidney shows distinct positivity in glomerular cells.
More information
 Immunohistochemical staining of human kidney shows membranous positivity in glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:450 1:500 1:450 1:80 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done Not done 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

1:73   1:80 1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

272.9, 223.7, 223.6, 126.0 272.9, 223.7, 223.6, 72.9 272.9, 223.7, 223.6, 126.0, 72.9, 62.7, 42.8 272.9, 223.7, 223.6, 126.0, 72.9 272.9, 223.7, 223.6, 126.0, 72.9 

Antibody dilution

1:250 1:250 1:260 1:500 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:6000 1:2100   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
CR1-001
 
CR1-002
 
CR1-003
 
CR1-007
 
CR1-010
 
CR1-011
 
CR1-012