HSD3B2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043261

 

Antibody HPA043264

 

Antibody HPA044028

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043261 HPA043264 HPA044028 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

36 37 54 

Antigen sequence

RGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWS
 
RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT
 
ESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEE
EPLE
 

Matching transcripts

HSD3B2-001 - ENSP00000358424 [97%]
HSD3B2-201 - ENSP00000445122 [97%]
 HSD3B2-001 - ENSP00000358424 [97%]
HSD3B2-201 - ENSP00000445122 [97%]
 HSD3B2-001 - ENSP00000358424 [100%]
HSD3B2-002 - ENSP00000388292 [100%]
HSD3B2-201 - ENSP00000445122 [100%]
 

Other gene match

HSD3B1 - ENSG00000203857 [100%]
 HSD3B1 - ENSG00000203857 [100%]
 HSD3B1 - ENSG00000203857 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:15 1:50 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.5, 42.3, 42.1 42.5, 42.3, 42.1 42.5, 42.3, 42.1, 21.7 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HSD3B2-001
 
HSD3B2-002
 
HSD3B2-201