BMPR2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017385

 

Antibody HPA049014

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA017385 HPA049014 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

107 125 

Antigen sequence

PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHI
GDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTP
LSPPHSF
 
QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKS
NLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGT
VLSGQTTNIVTHRAQEMLQNQFIGE
 

Matching transcripts

BMPR2-001 - ENSP00000363708 [100%]
BMPR2-002 - ENSP00000363702 [100%]
 BMPR2-001 - ENSP00000363708 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human spleen shows distinct cytoplasmic positivity in cells in red pulp.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:40  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

115.2, 60.0 115.2 

Antibody dilution

1:250 1:80 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:4450 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:111 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
BMPR2-001
 
BMPR2-002