PSMB8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046995

 

Antibody HPA050327

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046995 HPA050327 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

33 25 

Antigen sequence

GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
 
RPNLSPEEAYDLGRRAIAYATHRDS
 

Matching transcripts

PSMB8-001 - ENSP00000364015 [100%]
PSMB8-002 - ENSP00000364016 [100%]
PSMB8-004 - ENSP00000378748 [100%]
 PSMB8-001 - ENSP00000364015 [100%]
PSMB8-002 - ENSP00000364016 [100%]
PSMB8-004 - ENSP00000378748 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:650 1:900 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.4, 29.8, 27.9 30.4, 29.8, 27.9 

Antibody dilution

1:150 1:140 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1200 1:1150 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles & cytoskeleton (cytokinetic bridge).
More information
 

Antibody dilution

 1:28 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
PSMB8-001
 
PSMB8-002
 
PSMB8-004