MRPS18B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043485

 

Antibody HPA050334

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043485 HPA050334 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

79 90 

Antigen sequence

GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPE
RELSRLRRLYQGHLQEESGPPPESMPKMP
 
ASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYK
DEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRK
 

Matching transcripts

MRPS18B-001 - ENSP00000259873 [100%]
 MRPS18B-001 - ENSP00000259873 [100%]
MRPS18B-201 - ENSP00000445207 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows strong granular cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:250 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria & cell junctions.
More information
  

Antibody dilution

1:200  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

29.4 29.4, 14.0 

Antibody dilution

1:250 1:370 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MRPS18B-001
 
MRPS18B-201