DDR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA057194

 

Antibody CAB010162

 

Antibody CAB025656

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 R&D systems
 

Product name

HPA057194 sc-532 MAB2396 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Not known 

Released in version

12 4 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

38   

Antigen sequence

CPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
 
 
 

Matching transcripts

DDR1-001 - ENSP00000406091 [100%]
DDR1-002 - ENSP00000365752 [100%]
DDR1-003 - ENSP00000365753 [100%]
DDR1-005 - ENSP00000318217 [100%]
DDR1-006 - ENSP00000365751 [100%]
DDR1-012 - ENSP00000407699 [100%]
DDR1-018 - ENSP00000427552 [100%]
DDR1-020 - ENSP00000422442 [100%]
DDR1-204 - ENSP00000365754 [100%]
DDR1-205 - ENSP00000365759 [100%]
DDR1-207 - ENSP00000405039 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human bone marrow shows distinct cytoplasmic positivity in bone marrow poietic cells.
More information
 Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:150 1:150 

Validation IH

 Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

101.8, 101.1, 99.1, 97.2 101.8, 101.1, 99.1, 97.2, 53.8, 48.4, 31.9, 30.8, 29.6, 27.1, 23.2, 21.8, 21.5, 18.8, 18.5, 17.6, 16.9, 16.2, 15.8, 15.3, 14.5, 13.8, 13.2, 12.2, 11.9, 10.8, 9.0, 8.1, 7.8, 7.7, 7.4, 6.1, 5.8, 5.4, 4.4, 3.7 101.8, 101.1, 99.1, 97.2, 53.8, 48.4, 31.9, 30.8, 29.6, 27.1, 23.2, 21.8, 21.5, 18.8, 18.5, 17.6, 16.9, 16.2, 15.8, 15.3, 14.5, 13.8, 13.2, 12.2, 11.9, 10.8, 9.0, 8.1, 7.8, 7.7, 7.4, 6.1, 5.8, 5.4, 4.4, 3.7 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in cell junctions & nucleus but excluded from the nucleoli.
More information
   

Antibody dilution

1:76   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3050   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 « 
 
DDR1-001
 
DDR1-002
 
DDR1-003
 
DDR1-005
 
DDR1-006
 
DDR1-012
 
DDR1-018
 
DDR1-020
 
DDR1-204
 
DDR1-205
 
DDR1-207
 
 »