GPR56

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046065

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046065 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

88 

Antigen sequence

RDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASF
TFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQK
 

Matching transcripts

GPR56-001 - ENSP00000455215 [100%]
GPR56-002 - ENSP00000456794 [100%]
GPR56-004 - ENSP00000457456 [100%]
GPR56-005 - ENSP00000455351 [100%]
GPR56-006 - ENSP00000456620 [100%]
GPR56-007 - ENSP00000373465 [100%]
GPR56-009 - ENSP00000444911 [100%]
GPR56-025 - ENSP00000457953 [100%]
GPR56-065 - ENSP00000456238 [100%]
GPR56-202 - ENSP00000369018 [100%]
GPR56-203 - ENSP00000373464 [100%]
GPR56-204 - ENSP00000398034 [100%]
GPR56-205 - ENSP00000444415 [100%]
GPR56-037 - ENSP00000454855 [98%]
GPR56-029 - ENSP00000456682 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

77.7, 77.1, 29.0, 22.6, 22.3, 14.0 

Antibody dilution

1:120 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:950 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
GPR56-001
 
GPR56-002
 
GPR56-004
 
GPR56-005
 
GPR56-006
 
GPR56-007
 
GPR56-009
 
GPR56-025
 
GPR56-029
 
GPR56-037
 
GPR56-065
 
GPR56-202
 
GPR56-203
 
GPR56-204
 
GPR56-205
 
 »