CFI

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001143

 

Antibody HPA024061

 

Antibody CAB016777

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 BioPorto Diagnostics A/S
 

Product name

HPA001143 HPA024061 HYB 061-01 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

145 138  

Antigen sequence

GCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENY
NAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSG
WGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDG
 
ETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMK
ACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGED
EVGCAGFASVAQEETEILTADMDAERRRIKSLLPKLSC
 
 

Matching transcripts

CFI-001 - ENSP00000427438 [100%]
CFI-006 - ENSP00000378131 [100%]
CFI-201 - ENSP00000378130 [100%]
 CFI-201 - ENSP00000378130 [99%]
CFI-001 - ENSP00000427438 [95%]
CFI-006 - ENSP00000378131 [94%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human epididymis shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human duodenum shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:750 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

66.6, 65.7, 65.1 66.6, 65.7, 65.1 66.6, 65.7, 65.1, 18.3 

Antibody dilution

1:500 1:250 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
CFI-001
 
CFI-006
 
CFI-201