DEFB134

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044494

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044494 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

31 

Antigen sequence

GICRLECYESEMLVAYCMFQLECCVKGNPAP
 

Matching transcripts

DEFB134-001 - ENSP00000435010 [100%]
DEFB134-002 - ENSP00000371640 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Literature conformity

No avaliable characterization data 

RNA consistency

Not at all consistent with RNAseq data 

         Western Blot

Image

 

Description

Target too small/large to be analyzed with the present setup 

Target mass (kDa)

7.6 

Antibody dilution

 

Validation WB

Target too small/large to be analyzed with the present setup 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DEFB134-001
 
DEFB134-002