AC005841.1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040451

 

Antibody HPA043581

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040451 HPA043581 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

90 94 

Antigen sequence

QHTWGFHTWLDVCRLPATFPTQPDRPYDSNVWRWLTDSNAHRCPPTEHPI
PPPSWMGQNSFLTFIHCYPTFVDMKRKKQVIFRTVKELKE
 
ASFKKYRHISAGGRFEPQGLQLMPNPFPNNFARSWPCPNPLPHYQEKVLK
LALLPSAPLSQDLIRDFQTLIKDRTALPLHHLSKAQASKSPARK
 

Matching transcripts

AC005841.1-201 - ENSP00000372125 [100%]
 AC005841.1-201 - ENSP00000372125 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong nuclear and cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:600 1:60 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

36.2 36.2 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AC005841.1-201