C8orf44

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043660

 

Antibody HPA054753

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043660 HPA054753 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

79 43 

Antigen sequence

TKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPS
LKSQKPKRKRITGRKRLSKGFWSLLFSNL
 
MRKNESYLNQPAPPIPIPTLSLMGGCREHFENHWKGRARWLMP
 

Matching transcripts

C8orf44-001 - ENSP00000375087 [100%]
C8orf44-002 - ENSP00000428002 [100%]
 C8orf44-001 - ENSP00000375087 [100%]
C8orf44-002 - ENSP00000428002 [100%]
C8orf44-005 - ENSP00000431104 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:300  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:167 1:24 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

18.4 18.4, 9.8 

Antibody dilution

1:250 1:120 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:950 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
C8orf44-001
 
C8orf44-002
 
C8orf44-005