LTB4R

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003873

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003873 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

54 

Antigen sequence

GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPL
KLNE
 

Matching transcripts

LTB4R-001 - ENSP00000307445 [100%]
LTB4R-002 - ENSP00000380008 [100%]
LTB4R-003 - ENSP00000380002 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403631)
More information
 

Target mass (kDa)

37.6 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LTB4R-001
 
LTB4R-002
 
LTB4R-003