HOMEZ

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036316

 

Antibody HPA036317

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036316 HPA036317 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

75 55 

Antigen sequence

SSSFQVLANGATAASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHN
SVPGRVGPTEYLSPDMQRQRKTKRK
 
PDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRLPQPAEVV
VCLDE
 

Matching transcripts

HOMEZ-001 - ENSP00000350049 [100%]
HOMEZ-002 - ENSP00000453979 [100%]
HOMEZ-006 - ENSP00000475307 [100%]
HOMEZ-201 - ENSP00000406579 [100%]
 HOMEZ-001 - ENSP00000350049 [100%]
HOMEZ-002 - ENSP00000453979 [100%]
HOMEZ-201 - ENSP00000406579 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:600 1:100 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:182  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.7, 61.2, 30.0 61.7, 61.2 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HOMEZ-001
 
HOMEZ-002
 
HOMEZ-006
 
HOMEZ-201