CEBPZ-AS1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA053866

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA053866 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

41 

Antigen sequence

SKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQ
 

Matching transcripts

CEBPZ-AS1-001 - ENSP00000380403 [100%]
CEBPZ-AS1-002 - ENSP00000384331 [100%]
CEBPZ-AS1-005 - ENSP00000383895 [100%]
CEBPZ-AS1-006 - ENSP00000384813 [100%]
CEBPZ-AS1-007 - ENSP00000380254 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:20 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:10 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

9.3 

Antibody dilution

1:100 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:800 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CEBPZ-AS1-001
 
CEBPZ-AS1-002
 
CEBPZ-AS1-005
 
CEBPZ-AS1-006
 
CEBPZ-AS1-007